PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_20913.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 213aa    MW: 24158.9 Da    PI: 8.9853
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_20913.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.61.4e-331521162
                   zf-Dof 11 CdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             C+st+tkfCyynny+++qPr+fCkaC+ryWt GG++r vPvG+grrknk++s
  Rsa1.0_20913.1_g00001.1  1 CNSTETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPVGAGRRKNKNNS 52
                             *************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.0E-27150IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-22147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.574150IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
CNSTETKFCY YNNYNVNQPR HFCKACQRYW TSGGTMRSVP VGAGRRKNKN NSSSCSHNDH  60
HATISETSSP VLSFTHGEDQ NVSNNRLMHS WPYMWNPGFY PVYPYWNVPV LSPSPHSSPN  120
STIGKHSRDE DETVKQKQRN VSVLVPKTLR VDDPKEAAKS SIWTTLGIKN EVMFKGFDSK  180
KEVTIDKEET ETSLVLCANP AALSRSANFH ERL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895971e-109AC189597.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646992.11e-133PREDICTED: cyclic dof factor 1-like
SwissprotQ8W1E31e-113CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A078JQK11e-131A0A078JQK1_BRANA; BnaCnng61810D protein
TrEMBLA0A0D3BFS91e-131A0A0D3BFS9_BRAOL; Uncharacterized protein
STRINGBra010082.1-P1e-126(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-106cycling DOF factor 1